Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 1, Human (65a.a, His)

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NRG1-beta 1 Protein, Human (65a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1-protein-human.html

Purity

98.0

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Formula

3084 (Gene_ID) Q02297-6 (S177-E241) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCC Polyclonal Conjugated Antibody
orb1626936 100 µL

TBCC Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Hemoglobin Antibody
orb24669 1 mg

Hemoglobin Antibody

Sign In for Pricing
View Details
TRAV34 3'UTR GFP Stable Cell Line
TU076353 1.0 mL

TRAV34 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (AT13E10) [Janelia Fluor 646]
NBP2-61163JF646 0.1 mL

Mouse Monoclonal Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (AT13E10) [Janelia Fluor 646]

Sign In for Pricing
View Details
PE-Cy7 human CD20 Antibody
orb3065697-01 25 Tests

PE-Cy7 human CD20 Antibody

Sign In for Pricing
View Details
PE-Cy7 human CD20 Antibody
orb3065697-02 100 Tests

PE-Cy7 human CD20 Antibody

Sign In for Pricing
View Details