Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Rabbit Polyclonal Antibody (FITC)

DYNLL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LC8, PIN, DLC1, DLC8, LC8a, DNCL1, hdlc1, DNCLC1

UniProt

P63167

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DYNLL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tlr9 Antibody (FITC)
orb1271286 0.1 mg

Tlr9 Antibody (FITC)

Sign In for Pricing
View Details
Anti-Plakophilin 2/PKP2 Antibody Picoband®, Cy3 Conjugate
PA2278-Cy3 100 µg/Vial

Anti-Plakophilin 2/PKP2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
DAPK Substrate Peptide
orb1679172 1 mg

DAPK Substrate Peptide

Sign In for Pricing
View Details
COQ3 Rabbit pAb, BF700 conjugated
orb2876282 100 µL

COQ3 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2143103-01 0.1 mL

FITC-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2143103-02 0.2 mL

FITC-Linked Monoclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Sign In for Pricing
View Details