Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC5 Rabbit Polyclonal Antibody (Biotin)

KLHDC5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ctb9, KLHDC5

UniProt

Q9P2K6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLHDC5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065833

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MBD3 Rabbit Monoclonal Antibody
MA3623-.05 50 µL

Anti-MBD3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMV gB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 405) discontinued
C9100-21N-ML405 100 µL

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMV gB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 405) discontinued

Sign In for Pricing
View Details
β Tubulin rabbit pAb Antibody
orb2307826-01 50 µL

β Tubulin rabbit pAb Antibody

Sign In for Pricing
View Details
β Tubulin rabbit pAb Antibody
orb2307826-02 100 µL

β Tubulin rabbit pAb Antibody

Sign In for Pricing
View Details
Anti-FAM98B Rabbit Monoclonal Antibody
MA2561-.1 100 µL

Anti-FAM98B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLV3-U6-FOXD1 (human) -shRNA3-Puro
BZ61301 1 Vial

PLV3-U6-FOXD1 (human) -shRNA3-Puro

Sign In for Pricing
View Details