Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhdc9 Rabbit Polyclonal Antibody (FITC)

Klhdc9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ESTM3, ESTM31, AA087357, 1190002J23Rik

UniProt

Q3USL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human G protein-activated inward rectifier potassium channel 3,KCNJ9 ELISA KIT
JOT-EK1102Hu-01 48 Well

Human G protein-activated inward rectifier potassium channel 3,KCNJ9 ELISA KIT

Sign In for Pricing
View Details
Human G protein-activated inward rectifier potassium channel 3,KCNJ9 ELISA KIT
JOT-EK1102Hu-02 96 Well

Human G protein-activated inward rectifier potassium channel 3,KCNJ9 ELISA KIT

Sign In for Pricing
View Details
Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)
orb1652918-01 20 µg

Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)

Sign In for Pricing
View Details
Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)
orb1652918-02 100 µg

Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)

Sign In for Pricing
View Details
Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)
orb1652918-03 1 mg

Recombinant Mouse Lysyl oxidase homolog 2 (Loxl2)

Sign In for Pricing
View Details
ARHGEF1 Protein Vector (Mouse) (pPB-C-His)
PV155910 500 ng

ARHGEF1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details