Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIBC1 Rabbit Polyclonal Antibody (HRP)

RIBC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2610028I09Rik

UniProt

Q8N443

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RIBC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces Pombe SPAC8C9.12c Protein (aa 1-303)
VAng-Yyj5828-inquire Inquire

Recombinant Schizosaccharomyces Pombe SPAC8C9.12c Protein (aa 1-303)

Sign In for Pricing
View Details
TAF11 Rabbit Polyclonal Antibody
orb631702-01 50 µg

TAF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Rabbit Polyclonal Antibody
orb631702-02 100 µg

TAF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H2AFY2 (Core histone Macro-H2A.2, Histone macroH2A2, mH2A2, MACROH2A2) (MaxLight 550)
127695-ML550 100 µL

H2AFY2 (Core histone Macro-H2A.2, Histone macroH2A2, mH2A2, MACROH2A2) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human IQCB1 sgRNA gene knockout kit - Lentiviral human IQCB1 sgRNA gene knockout kit (plasmid)
GTR15370580 1 Vial

Lentiviral human IQCB1 sgRNA gene knockout kit - Lentiviral human IQCB1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MMP8 ELISA Kit (Human)
OKCD05953-96W 96 Well

MMP8 ELISA Kit (Human)

Sign In for Pricing
View Details