Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Rabbit Polyclonal Antibody (Biotin)

CTNND1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CTNND1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LBP Antibody Pair Set
E-KAB-0353 50 µL & 100 µg

Mouse LBP Antibody Pair Set

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF488A conjugate, 0.1mg/mL
BNC881855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPS17 Antibody
8C14036-AAT 50 µg

MRPS17 Antibody

Sign In for Pricing
View Details
PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]
TA801971BM 100 µL

PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Anti-GS-ll Antibody
TAL-2402-2 2 mL

Texas Red Conjugated Rabbit Anti-GS-ll Antibody

Sign In for Pricing
View Details