Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbcb Rabbit Polyclonal Antibody (FITC)

Tbcb Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cka, CG22, CKAPI, Ckap1, AU041393, 2410007D12Rik

UniProt

Q9D1E6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-Diethyl-p-phenylenediamine oxalate
FD33396 0.1 Kg

N, N-Diethyl-p-phenylenediamine oxalate

Sign In for Pricing
View Details
MAPKAP1 (Mitogen-activated Protein Kinase 2-associated Protein 1, Mitogen-activated Protein Kinase Associated Protein 1, MIP1, Stress-activated Map Kinase-interacting Protein 1, SAPK-interacting Protein 1, mSIN1, SIN1, Target of Rapamycin Complex 2 Subunit MAPKAP1, TORC2 Subunit MAPKAP1) (MaxLight 750) discontinued
M2354-88E-ML750 100 µL

MAPKAP1 (Mitogen-activated Protein Kinase 2-associated Protein 1, Mitogen-activated Protein Kinase Associated Protein 1, MIP1, Stress-activated Map Kinase-interacting Protein 1, SAPK-interacting Protein 1, mSIN1, SIN1, Target of Rapamycin Complex 2 Subunit MAPKAP1, TORC2 Subunit MAPKAP1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Sterile Sample Bags190x114,14oz/420ml, PE70, Iron wire width0.5MM/0.5MM, Cs/1000 (2x500)
SBL190114RR70WA 1000 Pieces/Case:1000 Pieces/ PACKS:1 PACKS/CASE

Sterile Sample Bags190x114,14oz/420ml, PE70, Iron wire width0.5MM/0.5MM, Cs/1000 (2x500)

Sign In for Pricing
View Details
UBE2K Protein Vector (Mouse) (pPB-C-His)
PV243586 500 ng

UBE2K Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Dnm1 shRNA (UAS) - Lentiviral mouse Dnm1 shRNA (UAS, GFP) (100)
GTR15264297 1 Vial

Lentiviral mouse Dnm1 shRNA (UAS) - Lentiviral mouse Dnm1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RHEB Antibody [L24C4]
F3784-100uL 100 µL

RHEB Antibody [L24C4]

Sign In for Pricing
View Details