Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp2 Rabbit Polyclonal Antibody (HRP)

Eif4ebp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PH, 4E-BP, 4E-BP2, PHAS-II, AA792569, BC010348, 2810011I19Rik

UniProt

P70445

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS1, NT (GAS1, Growth arrest-specific protein 1) (MaxLight 550)
MBS6301265-01 0.1 mL

GAS1, NT (GAS1, Growth arrest-specific protein 1) (MaxLight 550)

Sign In for Pricing
View Details
GAS1, NT (GAS1, Growth arrest-specific protein 1) (MaxLight 550)
MBS6301265-02 5x 0.1 mL

GAS1, NT (GAS1, Growth arrest-specific protein 1) (MaxLight 550)

Sign In for Pricing
View Details
Human PNMA8B Knockout A549 cell line
GTR15412961 1 Vial

Human PNMA8B Knockout A549 cell line

Sign In for Pricing
View Details
ABCG5 Antibody
orb784008 2 mg

ABCG5 Antibody

Sign In for Pricing
View Details
Frozen Tissue Section - Human Adult Normal: Brain: Medulla Oblongata
T1234057 5 Slides

Frozen Tissue Section - Human Adult Normal: Brain: Medulla Oblongata

Sign In for Pricing
View Details
RPS20 Rabbit Polyclonal Antibody (Cy5.5)
orb1072281 100 µL

RPS20 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details