Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP8 Rabbit Polyclonal Antibody (Biotin)

DUSP8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HB5, HVH8, HVH-5, C11orf81

UniProt

Q13202

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DUSP8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX21 Rabbit pAb, AP conjugated
orb2870314 100 µL

DDX21 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Porcine Interleukin 7 IL-7 ELISA Kit
BG-POR11380 1 Each

Porcine Interleukin 7 IL-7 ELISA Kit

Sign In for Pricing
View Details
Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit
MBS1605512-01 48 Well

Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit

Sign In for Pricing
View Details
Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit
MBS1605512-02 96 Well

Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit

Sign In for Pricing
View Details
Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit
MBS1605512-03 5x 96 Well

Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit

Sign In for Pricing
View Details
Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit
MBS1605512-04 10x 96 Well

Mouse Parathyroid Hormone Related Protein, PTHrP ELISA Kit

Sign In for Pricing
View Details