Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF7 Rabbit Polyclonal Antibody (Biotin)

DCAF7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AN11, HAN11, WDR68, SWAN-1

UniProt

P61962

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLEC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005819

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLKO.1-U6-KAT2A (human) -shRNA5-PGK-Puro
BZ39878 1 Vial

PLKO.1-U6-KAT2A (human) -shRNA5-PGK-Puro

Sign In for Pricing
View Details
Human Myosin light polypeptide 6 (MYL6) ELISA Kit
MBS7207141-01 48 Well

Human Myosin light polypeptide 6 (MYL6) ELISA Kit

Sign In for Pricing
View Details
Human Myosin light polypeptide 6 (MYL6) ELISA Kit
MBS7207141-02 96 Well

Human Myosin light polypeptide 6 (MYL6) ELISA Kit

Sign In for Pricing
View Details
Human Myosin light polypeptide 6 (MYL6) ELISA Kit
MBS7207141-03 5x 96 Well

Human Myosin light polypeptide 6 (MYL6) ELISA Kit

Sign In for Pricing
View Details
Human Myosin light polypeptide 6 (MYL6) ELISA Kit
MBS7207141-04 10x 96 Well

Human Myosin light polypeptide 6 (MYL6) ELISA Kit

Sign In for Pricing
View Details
Gallus Ovalbumin Antibody (Cy7)
orb2986988-01 100 µL

Gallus Ovalbumin Antibody (Cy7)

Sign In for Pricing
View Details