Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIDA Rabbit Polyclonal Antibody (Biotin)

RIDA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PSP, P14.5, UK114, HRSP12, hp14.5

UniProt

P52758

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human UK114

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: INDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp983 shRNA (UAS) - Lentiviral mouse Zfp983 shRNA (UAS, RFP) plasmid
GTR15195841 1 Vial

Lentiviral mouse Zfp983 shRNA (UAS) - Lentiviral mouse Zfp983 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Cyclophilin B Monoclonal Antibody (2B10)
orb380447-01 50 μL

Cyclophilin B Monoclonal Antibody (2B10)

Sign In for Pricing
View Details
Cyclophilin B Monoclonal Antibody (2B10)
orb380447-02 100 µL

Cyclophilin B Monoclonal Antibody (2B10)

Sign In for Pricing
View Details
Spata1 ORF Vector (Mouse) (pORF)
ORF058258 1.0 µg DNA

Spata1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Receptor I For The Fc Region Of Immunoglobulin G (FcgRI)
MBS2056758-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Receptor I For The Fc Region Of Immunoglobulin G (FcgRI)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Receptor I For The Fc Region Of Immunoglobulin G (FcgRI)
MBS2056758-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Receptor I For The Fc Region Of Immunoglobulin G (FcgRI)

Sign In for Pricing
View Details