Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHP Rabbit Polyclonal Antibody (FITC)

CHP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHP, p22, p24, SPAX9, Sid470p, SLC9A1BP

UniProt

Q99653

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_009167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to EphA2
MAB-606020071 0.1ml

Mouse Monoclonal Antibody to EphA2

Sign In for Pricing
View Details
PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued
212905-01 50 µL

PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued

Sign In for Pricing
View Details
PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued
212905-02 100 µL

PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued

Sign In for Pricing
View Details
PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued
212905-03 200 µL

PTK2, phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) discontinued

Sign In for Pricing
View Details
Recombinant Rhodococcus erythropolis DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1052897 Inquire

Recombinant Rhodococcus erythropolis DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
CD2 antibody
2PP-100T 100 Tests

CD2 antibody

Sign In for Pricing
View Details