Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Rabbit Polyclonal Antibody (HRP)

TWF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TWF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP14 (Matrix Metalloproteinase-14, MMP-14, MMP-X1, Membrane-type Matrix Metalloproteinase 1, MT-MMP 1, MTMMP1, Membrane-type-1 Matrix Metalloproteinase, MT1-MMP, MT1MMP) (HRP)
MBS6385636-01 0.1 mL

MMP14 (Matrix Metalloproteinase-14, MMP-14, MMP-X1, Membrane-type Matrix Metalloproteinase 1, MT-MMP 1, MTMMP1, Membrane-type-1 Matrix Metalloproteinase, MT1-MMP, MT1MMP) (HRP)

Sign In for Pricing
View Details
MMP14 (Matrix Metalloproteinase-14, MMP-14, MMP-X1, Membrane-type Matrix Metalloproteinase 1, MT-MMP 1, MTMMP1, Membrane-type-1 Matrix Metalloproteinase, MT1-MMP, MT1MMP) (HRP)
MBS6385636-02 5x 0.1 mL

MMP14 (Matrix Metalloproteinase-14, MMP-14, MMP-X1, Membrane-type Matrix Metalloproteinase 1, MT-MMP 1, MTMMP1, Membrane-type-1 Matrix Metalloproteinase, MT1-MMP, MT1MMP) (HRP)

Sign In for Pricing
View Details
MRS2 Polyclonal Antibody
MBS9236427-01 0.1 mL

MRS2 Polyclonal Antibody

Sign In for Pricing
View Details
MRS2 Polyclonal Antibody
MBS9236427-02 5x 0.1 mL

MRS2 Polyclonal Antibody

Sign In for Pricing
View Details
NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4, BAR, FXR, HRR-1, HRR1, MGC163445, RIP14) (APC)
249457-APC 100 µL

NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4, BAR, FXR, HRR-1, HRR1, MGC163445, RIP14) (APC)

Sign In for Pricing
View Details
3,4-dihydro-1h-spiro[naphthalene-2,4'-piperidine] hcl
XAC75822-01 50 mg

3,4-dihydro-1h-spiro[naphthalene-2,4'-piperidine] hcl

Sign In for Pricing
View Details