Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfm3 Rabbit Polyclonal Antibody (HRP)

Olfm3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Opti, B230206G02Rik

UniProt

P63056

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694797

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rim2 RIMS2 Antibody
A09915-1 0.1 mg

Anti-Rim2 RIMS2 Antibody

Sign In for Pricing
View Details
LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (Biotin)
129280-Biotin 100 µL

LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (Biotin)

Sign In for Pricing
View Details
HSV 2 (strain 333) Glycoprotein B/gB Protein (His)
TMPY-06816-01 5 µg

HSV 2 (strain 333) Glycoprotein B/gB Protein (His)

Sign In for Pricing
View Details
HSV 2 (strain 333) Glycoprotein B/gB Protein (His)
TMPY-06816-02 10 µg

HSV 2 (strain 333) Glycoprotein B/gB Protein (His)

Sign In for Pricing
View Details
HSV 2 (strain 333) Glycoprotein B/gB Protein (His)
TMPY-06816-03 20 µg

HSV 2 (strain 333) Glycoprotein B/gB Protein (His)

Sign In for Pricing
View Details
HSV 2 (strain 333) Glycoprotein B/gB Protein (His)
TMPY-06816-04 50 µg

HSV 2 (strain 333) Glycoprotein B/gB Protein (His)

Sign In for Pricing
View Details