Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf160 Rabbit Polyclonal Antibody (FITC)

C20orf160 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C20orf160, dJ310O13.5

UniProt

Q9NUG4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf160

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
MBS2703727-01 24 Strip Well

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
MBS2703727-02 48 Well

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
MBS2703727-03 96 Well

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
MBS2703727-04 5x 96 Well

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
MBS2703727-05 10x 96 Well

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
CFHR2 Antibody, FITC conjugated
MBS1493386-01 0.05 mg

CFHR2 Antibody, FITC conjugated

Sign In for Pricing
View Details