Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp19 Rabbit Polyclonal Antibody (Biotin)

Dusp19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D4A8F3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101209

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAM68 (KHDRBS1) (NM_006559) Human Over-expression Lysate
LH08256V 100 µg

SAM68 (KHDRBS1) (NM_006559) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit
DL-LTBP1-Mu-01 48 Tests

Mouse Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit
DL-LTBP1-Mu-02 96 Tests

Mouse Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) ELISA Kit

Sign In for Pricing
View Details
Lta (NM_010735) Mouse Tagged ORF Clone
MG226758 10 µg

Lta (NM_010735) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hemoglobin A1c antibody
MBS5317775-01 1 mL

Hemoglobin A1c antibody

Sign In for Pricing
View Details
Hemoglobin A1c antibody
MBS5317775-02 5x 1 mL

Hemoglobin A1c antibody

Sign In for Pricing
View Details