Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYW3 Rabbit Polyclonal Antibody (FITC)

TYW3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C1orf171

UniProt

Q6IPR3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TYW3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (AP) discontinued
123314-AP 100 µL

Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (AP) discontinued

Sign In for Pricing
View Details
TLR2 (Toll-like Receptor 2, CD282, TIL4) (AP) discontinued
252732-AP 100 µL

TLR2 (Toll-like Receptor 2, CD282, TIL4) (AP) discontinued

Sign In for Pricing
View Details
DHRS7B Antibody, Biotin conjugated
MBS1494675-01 0.05 mg

DHRS7B Antibody, Biotin conjugated

Sign In for Pricing
View Details
DHRS7B Antibody, Biotin conjugated
MBS1494675-02 0.1 mg

DHRS7B Antibody, Biotin conjugated

Sign In for Pricing
View Details
DHRS7B Antibody, Biotin conjugated
MBS1494675-03 5x 0.1 mg

DHRS7B Antibody, Biotin conjugated

Sign In for Pricing
View Details
OB Cadherin Blocking Peptide
orb706456-01 1 mg

OB Cadherin Blocking Peptide

Sign In for Pricing
View Details