Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA17 Rabbit Polyclonal Antibody (Biotin)

SPATA17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11

UniProt

Q96L03

Immunogen

The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

XP_005273109.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM101 Antibody Blocking peptide
orb1449034 500 µg

TMEM101 Antibody Blocking peptide

Sign In for Pricing
View Details
Hemagglutinin, Influenza A Virus (H5N1/HA1)
532314-01 50 µL

Hemagglutinin, Influenza A Virus (H5N1/HA1)

Sign In for Pricing
View Details
Hemagglutinin, Influenza A Virus (H5N1/HA1)
532314-02 100 µL

Hemagglutinin, Influenza A Virus (H5N1/HA1)

Sign In for Pricing
View Details
Adenoma of ovary
4220e 7.6 x 2.6 cm

Adenoma of ovary

Sign In for Pricing
View Details
Culture Medium for Human Colorectal Cancer Cells [C0L0320 DM]
AFG-ELL-1270-01 125 mL

Culture Medium for Human Colorectal Cancer Cells [C0L0320 DM]

Sign In for Pricing
View Details
Culture Medium for Human Colorectal Cancer Cells [C0L0320 DM]
AFG-ELL-1270-02 500 mL

Culture Medium for Human Colorectal Cancer Cells [C0L0320 DM]

Sign In for Pricing
View Details