Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRA Rabbit Polyclonal Antibody (FITC)

ABRA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STARS

UniProt

Q8N0Z2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABRA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_631905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL2 (NM_030937) Human Over-expression Lysate
LY410653 100 µg

CCNL2 (NM_030937) Human Over-expression Lysate

Sign In for Pricing
View Details
Ndufv3 (NM_030087) Mouse Tagged Lenti ORF Clone
MR207506L4 10 µg

Ndufv3 (NM_030087) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)
MBS2154081-01 0.01 mg

Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)

Sign In for Pricing
View Details
Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)
MBS2154081-02 0.05 mg

Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)

Sign In for Pricing
View Details
Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)
MBS2154081-03 0.1 mg

Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)

Sign In for Pricing
View Details
Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)
MBS2154081-04 0.2 mg

Recombinant Protein Phosphatase 3, Catalytic Subunit Beta Isoform (PPP3Cb)

Sign In for Pricing
View Details