Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhebl1 Rabbit Polyclonal Antibody (FITC)

Rhebl1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rheb, Rheb2, 1810036J22Rik

UniProt

Q9D8T3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 Recombinant Mouse Monoclonal Antibody [A2F8-R]
HA601286 100 µL

CD43 Recombinant Mouse Monoclonal Antibody [A2F8-R]

Sign In for Pricing
View Details
CD11a (ITGAL) (NM_002209) Human Over-expression Lysate
LY400809 100 µg

CD11a (ITGAL) (NM_002209) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), Biotin conjugate, 0.1mg/mL
BNCB1777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mmp11 activation kit by CRISPRa
GA202676 1 Kit

Mouse Mmp11 activation kit by CRISPRa

Sign In for Pricing
View Details
Cenpa (NM_007681) Mouse Tagged ORF Clone
MG200793 10 µg

Cenpa (NM_007681) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF740 conjugate, 0.1mg/mL
BNC743807-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details