Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5D1 Rabbit Polyclonal Antibody (FITC)

CYB5D1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ32499

UniProt

Q6P9G0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYB5D1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_653208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIP1 Polyclonal Antibody
JOT-AP08320-01 20 µL

SIP1 Polyclonal Antibody

Sign In for Pricing
View Details
SIP1 Polyclonal Antibody
JOT-AP08320-02 50 μL

SIP1 Polyclonal Antibody

Sign In for Pricing
View Details
SIP1 Polyclonal Antibody
JOT-AP08320-03 100 µL

SIP1 Polyclonal Antibody

Sign In for Pricing
View Details
RALY Polyclonal Antibody, Biotin Conjugated
A69318-100 100 µL

RALY Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Primary Canine Seminal Vesicle Epithelial Cells (SVEC)
TRV-0018516 5x 10^5 Cells

Primary Canine Seminal Vesicle Epithelial Cells (SVEC)

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Not for Export EU)
G8951-32-01 20 µL

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Not for Export EU)

Sign In for Pricing
View Details