Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIART Rabbit Polyclonal Antibody (HRP)

CIART Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GM129, CHRONO, C1orf51

UniProt

Q8N365

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf51

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC2L1 (DYNC2LI1) Human Gene Knockout Kit (CRISPR)
KN402656 1 Kit

DC2L1 (DYNC2LI1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF594 conjugate, 0.1mg/mL
BNC942206-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAB21 (NM_014999) Human Recombinant Protein
TP310510L 1 mg

RAB21 (NM_014999) Human Recombinant Protein

Sign In for Pricing
View Details
MRPS21 Human Gene Knockout Kit (CRISPR)
KN400860 1 Kit

MRPS21 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDON Antibody
8C12181-AAT 50 µg

CDON Antibody

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF647 conjugate, 0.1mg/mL
BNC471860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details