Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOML3 Rabbit Polyclonal Antibody (Biotin)

STOML3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SRO, Epb7.2l

UniProt

Q8TAV4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STOML3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660329

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxcl6 Rat shRNA Plasmid (Locus ID 60665)
TL710592 1 Kit

Cxcl6 Rat shRNA Plasmid (Locus ID 60665)

Sign In for Pricing
View Details
Amhr2 Antibody - N-terminal region : HRP (ARP49527_P050-HRP)
ARP49527_P050-HRP 100 µL

Amhr2 Antibody - N-terminal region : HRP (ARP49527_P050-HRP)

Sign In for Pricing
View Details
N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag
056811-01 10 µg

N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag
056811-02 50 µg

N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag
056811-03 100 µg

N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag
056811-04 200 µg

N-Terminal Pro-Atrial Natriuretic Peptide (NT-ProANP), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details