Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WFDC5 Rabbit Polyclonal Antibody (HRP)

WFDC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRG5, WAP1, dJ211D12.5

UniProt

Q8TCV5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WFDC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_663627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)
abx306995-01 20 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)

Sign In for Pricing
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)
abx306995-02 50 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)

Sign In for Pricing
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)
abx306995-03 100 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)

Sign In for Pricing
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)
abx306995-04 200 µg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)

Sign In for Pricing
View Details
Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)
abx306995-05 1 mg

Microtubule-Associated Protein RP/EB Family Member 1 (MAPRE1) Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Mouse NGF/NGFB/beta-NGF protein (His tag)
MBS2571144-01 0.02 mg

Recombinant Mouse NGF/NGFB/beta-NGF protein (His tag)

Sign In for Pricing
View Details