Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HUS1B Rabbit Polyclonal Antibody (HRP)

HUS1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126746, MGC126748, RP11-532F6.1

UniProt

Q8NHY5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HUS1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_683762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrpb 3'UTR Luciferase Stable Cell Line
TU220903 1.0 mL

Snrpb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
COL9A1 Antibody
OACD00429-1ML 1 mL

COL9A1 Antibody

Sign In for Pricing
View Details
SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 550)
MBS6346775-01 0.1 mL

SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 550)

Sign In for Pricing
View Details
SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 550)
MBS6346775-02 5x 0.1 mL

SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 550)

Sign In for Pricing
View Details
Mouse CS (Citrate Synthase) ELISA Kit
ELK4744-01 48 Tests

Mouse CS (Citrate Synthase) ELISA Kit

Sign In for Pricing
View Details
Mouse CS (Citrate Synthase) ELISA Kit
ELK4744-02 96 Tests

Mouse CS (Citrate Synthase) ELISA Kit

Sign In for Pricing
View Details