Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HUS1B Rabbit Polyclonal Antibody (HRP)

HUS1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126746, MGC126748, RP11-532F6.1

UniProt

Q8NHY5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HUS1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_683762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Stathmin-2/STMN2 Antibody [PerCP]
NBP1-49461PCP 0.1 mL

Rabbit Polyclonal Stathmin-2/STMN2 Antibody [PerCP]

Sign In for Pricing
View Details
SYBU CRISPR All-in-one AAV vector set (with saCas9)(Human)
45941151 3x 1.0 µg DNA

SYBU CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (MaxLight 490)
128754-ML490 100 µL

KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Human MXRA8/DICAM Protein CF
8939-DM-050 50 µg

Recombinant Human MXRA8/DICAM Protein CF

Sign In for Pricing
View Details
Armenian Hamster Monoclonal CD79B Antibody (HM79-12) [FITC]
NBP1-28141 0.25 mg

Armenian Hamster Monoclonal CD79B Antibody (HM79-12) [FITC]

Sign In for Pricing
View Details
SARS-CoV-2 S Protein antibody
E55A11622 100 µg

SARS-CoV-2 S Protein antibody

Sign In for Pricing
View Details