Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT222P Rabbit Polyclonal Antibody (FITC)

KRT222P Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KA21, KRT222P

UniProt

Q8N1A0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT222P

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)
MBS6252977-01 0.1 mL

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)

Sign In for Pricing
View Details
Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)
MBS6252977-02 5x 0.1 mL

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)

Sign In for Pricing
View Details
CDNA library, Rat NRK Cell Log Phase
02-719 Inquire

CDNA library, Rat NRK Cell Log Phase

Sign In for Pricing
View Details
MAP-6D1 CRISPR/Cas9 KO Plasmid (h)
sc-410140 20 µg

MAP-6D1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Monkey Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit
DLR-MCP1-Si-96T 96 Tests

Monkey Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 187 (ZNF187) ELISA Kit
EIA06916h 1 Kit

Human Zinc finger protein 187 (ZNF187) ELISA Kit

Sign In for Pricing
View Details