Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf131 Rabbit Polyclonal Antibody (HRP)

C1orf131 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp547B1713

UniProt

Q8NDD1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf131

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD3 (NM_001248) Human Tagged Lenti ORF Clone
RC212912L2 10 µg

ENTPD3 (NM_001248) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Calcyclin Binding Protein (CACYBP) CLIA Kit
abx196769 96 Tests

Mouse Calcyclin Binding Protein (CACYBP) CLIA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal RPL36 Antibody [mFluor Violet 610 SE]
NBP2-97618MFV610 0.1 mL

Rabbit Polyclonal RPL36 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SAE1, Recombinant, Human, aa1-346, His-T7 Tag (SUMO1 activating Enzyme Subunit 1, AOS1, HSPC140, SUA1, UBLE1A)
351486-01 50 µg

SAE1, Recombinant, Human, aa1-346, His-T7 Tag (SUMO1 activating Enzyme Subunit 1, AOS1, HSPC140, SUA1, UBLE1A)

Sign In for Pricing
View Details
SAE1, Recombinant, Human, aa1-346, His-T7 Tag (SUMO1 activating Enzyme Subunit 1, AOS1, HSPC140, SUA1, UBLE1A)
351486-02 250 µg

SAE1, Recombinant, Human, aa1-346, His-T7 Tag (SUMO1 activating Enzyme Subunit 1, AOS1, HSPC140, SUA1, UBLE1A)

Sign In for Pricing
View Details
AFF3 Antibody - middle region : FITC (ARP34237_P050-FITC)
ARP34237_P050-FITC 100 µL

AFF3 Antibody - middle region : FITC (ARP34237_P050-FITC)

Sign In for Pricing
View Details