Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRFN5 Rabbit Polyclonal Antibody (Biotin)

LRFN5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SALM5, FIGLER8, C14orf146

UniProt

Q96NI6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRFN5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine h (hydrochloride)
HY-D1024A-01 5 mg

Coelenterazine h (hydrochloride)

Sign In for Pricing
View Details
Coelenterazine h (hydrochloride)
HY-D1024A-02 10 mg

Coelenterazine h (hydrochloride)

Sign In for Pricing
View Details
PARD6B (Partitioning Defective 6 Homolog beta, PAR-6 beta, PAR-6B, PAR6B) APC
MBS6388438-01 0.1 mL

PARD6B (Partitioning Defective 6 Homolog beta, PAR-6 beta, PAR-6B, PAR6B) APC

Sign In for Pricing
View Details
PARD6B (Partitioning Defective 6 Homolog beta, PAR-6 beta, PAR-6B, PAR6B) APC
MBS6388438-02 5x 0.1 mL

PARD6B (Partitioning Defective 6 Homolog beta, PAR-6 beta, PAR-6B, PAR6B) APC

Sign In for Pricing
View Details
ABCC4 (ATP-binding Cassette Sub-Family C Member 4, EST170205, MOAT-B, MOATB, MRP4) (MaxLight 650)
MBS6404977-01 0.1 mL

ABCC4 (ATP-binding Cassette Sub-Family C Member 4, EST170205, MOAT-B, MOATB, MRP4) (MaxLight 650)

Sign In for Pricing
View Details
ABCC4 (ATP-binding Cassette Sub-Family C Member 4, EST170205, MOAT-B, MOATB, MRP4) (MaxLight 650)
MBS6404977-02 5x 0.1 mL

ABCC4 (ATP-binding Cassette Sub-Family C Member 4, EST170205, MOAT-B, MOATB, MRP4) (MaxLight 650)

Sign In for Pricing
View Details