Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eid2 Rabbit Polyclonal Antibody (HRP)

Eid2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cr, Cri2, EID-, EID-2

UniProt

Q6X7S9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_940817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIBRARY COPIER, Registers FP Series Floating Replicator to 96 and 384 Well Standard Microplates
VP 381N 1 EACH

LIBRARY COPIER, Registers FP Series Floating Replicator to 96 and 384 Well Standard Microplates

Sign In for Pricing
View Details
Human CellExp™ NKG2D / CD314, Fc Tag, Human Recombinant
P1484-50 50 µg

Human CellExp™ NKG2D / CD314, Fc Tag, Human Recombinant

Sign In for Pricing
View Details
Monoclonal Anti-Human Xeroderma pigmentosum type G (XPG) protein ab #1
XPG11-M 100 µg

Monoclonal Anti-Human Xeroderma pigmentosum type G (XPG) protein ab #1

Sign In for Pricing
View Details
SLC25A5P7 3'UTR GFP Stable Cell Line
TU073481 1.0 mL

SLC25A5P7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human fetal hemoglobin, HBF ELISA KIT
EA0062Hu-01 96 Well

Human fetal hemoglobin, HBF ELISA KIT

Sign In for Pricing
View Details
RNASE1L2 Adenovirus (Rat)
40199056 1.0 mL

RNASE1L2 Adenovirus (Rat)

Sign In for Pricing
View Details