Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL16 Rabbit Polyclonal Antibody (HRP)

FBXL16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbl16, C16orf22, c380A1.1

UniProt

Q8N461

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBXL16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN31 (Center) Rabbit Polyclonal Antibody
AP18231PU-N 400 µL

TSPAN31 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP5L2 (NM_001165877) Human Over-expression Lysate
LY431072 100 µg

ATP5L2 (NM_001165877) Human Over-expression Lysate

Sign In for Pricing
View Details
Cotl1 Mouse Gene Knockout Kit (CRISPR)
KN503710 1 Kit

Cotl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGEB2 (N-term) Rabbit Polyclonal Antibody
AP13137PU-N 400 µL

MAGEB2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS647171 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
NUDT13 (NM_001283017) Human Tagged ORF Clone
RG236115 10 µg

NUDT13 (NM_001283017) Human Tagged ORF Clone

Sign In for Pricing
View Details