Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf53 Rabbit Polyclonal Antibody (HRP)

C12orf53 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PANP, LEDA1, leda-1, C12orf53

UniProt

Q8IYJ0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C12orf53

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_710152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details