Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rdh10 Rabbit Polyclonal Antibody (FITC)

Rdh10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q80ZF7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_852143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fpr3-set siRNA/shRNA/RNAi Lentivector (Mouse)
20814094 4x 500 ng

Fpr3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Pp2d1 Protein Lysate (Human) with C-Ha Tag
37283031 100 µg

Pp2d1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-Purple sea urchin Integrin BG Antibody Fluoro550 Conjugated
DZ41518-Fluoro550 200 µL/Vial

Anti-Purple sea urchin Integrin BG Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Mouse Lipase, Gastric (LIPF) ELISA kit
YLA0213MO-01 48 Tests

Mouse Lipase, Gastric (LIPF) ELISA kit

Sign In for Pricing
View Details
Mouse Lipase, Gastric (LIPF) ELISA kit
YLA0213MO-02 96 Tests

Mouse Lipase, Gastric (LIPF) ELISA kit

Sign In for Pricing
View Details
Chicken Procollagen lysine,2 oxoglutarate 5 dioxygenase 1 (PLOD1) ELISA kit
GTR10401622 96 Well

Chicken Procollagen lysine,2 oxoglutarate 5 dioxygenase 1 (PLOD1) ELISA kit

Sign In for Pricing
View Details