Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cntd1 Rabbit Polyclonal Antibody (FITC)

Cntd1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1564542

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TQLHATCLTLLDLVYLLHEPIYESLLRASIENSPPSQLQGEKFISVKEDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001184146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM2 Rabbit Polyclonal Antibody (Biotin)
orb2107519 100 µL

ADAM2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Seward Stomacher 400 Classic Strainer Bag
MIX3108 200 / PCK

Seward Stomacher 400 Classic Strainer Bag

Sign In for Pricing
View Details
KIAA0175 Kinase (PE) discontinued
K1745-55-PE 100 µL

KIAA0175 Kinase (PE) discontinued

Sign In for Pricing
View Details
Lentiviral human TRIL shRNA (UAS) - Lentiviral human TRIL shRNA (UAS, GFP) (25)
GTR15107408 1 Vial

Lentiviral human TRIL shRNA (UAS) - Lentiviral human TRIL shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Bovine Prolactin ELISA Kit
orb403226-01 24 Tests

Bovine Prolactin ELISA Kit

Sign In for Pricing
View Details
Bovine Prolactin ELISA Kit
orb403226-02 48 Tests

Bovine Prolactin ELISA Kit

Sign In for Pricing
View Details