Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFCAB3 Rabbit Polyclonal Antibody (Biotin)

EFCAB3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ25818, MGC126801, MGC126827

UniProt

Q8N7B9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EFCAB3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_775774

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monkey CD274 Protein, Fc-tagged, Alexa Fluor 647 conjugated
CD274-130CAF647 20 μg- 50 μg- 100 μg

Recombinant Monkey CD274 Protein, Fc-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
SPNS1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2395142 100 µL

SPNS1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit
MBS9380572-01 48 Strip Well

Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit

Sign In for Pricing
View Details
Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit
MBS9380572-02 96 Strip Well

Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit

Sign In for Pricing
View Details
Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit
MBS9380572-03 5x 96 Strip Well

Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit

Sign In for Pricing
View Details
Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit
MBS9380572-04 10x 96 Strip Well

Sheep Friend Leukemia Integration 1 Transcription Factor (FLI1) ELISA Kit

Sign In for Pricing
View Details