Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRA16 Rabbit Polyclonal Antibody (HRP)

TRA16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRA16

UniProt

Q86WQ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRA16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_795361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIST, CT (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (MaxLight 405) discontinued
P4207-52B-ML405 100 µL

PIST, CT (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AMG 337
B6193-25 25 mg

AMG 337

Sign In for Pricing
View Details
Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)
MBS1004021-01 0.02 mg (E-Coli)

Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)

Sign In for Pricing
View Details
Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)
MBS1004021-02 0.02 mg (Yeast)

Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)

Sign In for Pricing
View Details
Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)
MBS1004021-03 0.1 mg (E-Coli)

Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)

Sign In for Pricing
View Details
Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)
MBS1004021-04 0.1 mg (Yeast)

Recombinant Rhodospirillum rubrum Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC)

Sign In for Pricing
View Details