Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC50 Rabbit Polyclonal Antibody (HRP)

LRRC50 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
3-Hydroxy-4-(1-naphthalenyloxy)-butanimidic Acid Ethyl Ester Hydrochloride
TRC-H951060-25MG 25 mg

3-Hydroxy-4-(1-naphthalenyloxy)-butanimidic Acid Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit
RDR-MYH2-Mu-01 96 Tests

Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit
RDR-MYH2-Mu-02 48 Tests

Mouse Myosin Heavy Chain 2, Skeletal Muscle, Adult (MYH2) ELISA Kit

Sign In for Pricing
View Details