Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB7 Rabbit Polyclonal Antibody (HRP)

ASB7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ22551

UniProt

Q9H672

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASB7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_937886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCLM (Glutamate-cysteine Ligase Modifier Subunit, Gamma-glutamylcysteine Synthetase Regulatory Subunit, Gamma-ECS Regulatory Subunit, GCS Light Chain, Glutamate-cysteine Ligase Regulatory Subunit, GLCLR) (FITC)
127233-FITC 100 µL

GCLM (Glutamate-cysteine Ligase Modifier Subunit, Gamma-glutamylcysteine Synthetase Regulatory Subunit, Gamma-ECS Regulatory Subunit, GCS Light Chain, Glutamate-cysteine Ligase Regulatory Subunit, GLCLR) (FITC)

Sign In for Pricing
View Details
FSCB Rabbit Polyclonal Antibody (Cy7)
orb1080643 100 µL

FSCB Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Mouse Unc93a2 qPCR Primer Pair
QM76978S 200 Tests

Mouse Unc93a2 qPCR Primer Pair

Sign In for Pricing
View Details
PRSS21 (ESP1, TEST1, Testisin, Eosinophil Serine Protease 1, Serine Protease 21) (FITC)
131907-FITC 100 µL

PRSS21 (ESP1, TEST1, Testisin, Eosinophil Serine Protease 1, Serine Protease 21) (FITC)

Sign In for Pricing
View Details
Anti-CSK Rabbit Monoclonal Antibody
MA2056-.05 50 µL

Anti-CSK Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BAG6 Rabbit pAb, PerCP-Cy7 conjugated
orb2855595 100 µL

BAG6 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details