Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC23 Rabbit Polyclonal Antibody (HRP)

LRRC23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRPB7

UniProt

Q53EV4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRRC23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_964013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP26 polyclonal antibody
orb1720207-01 50 µL

MMP26 polyclonal antibody

Sign In for Pricing
View Details
MMP26 polyclonal antibody
orb1720207-02 100 µL

MMP26 polyclonal antibody

Sign In for Pricing
View Details
CD49f (CD49 Antigen-like Family Member F, CD49f Antigen, Integrin alpha 6, Integrin alpha-6, ITGA6, ITGA6B, VLA 6 alpha Subunit, VLA-6) discontinued
C2405-03H 1 mL

CD49f (CD49 Antigen-like Family Member F, CD49f Antigen, Integrin alpha 6, Integrin alpha-6, ITGA6, ITGA6B, VLA 6 alpha Subunit, VLA-6) discontinued

Sign In for Pricing
View Details
Mouse Grpel2 qPCR Primer Pair
QM17250S 200 Tests

Mouse Grpel2 qPCR Primer Pair

Sign In for Pricing
View Details
TRIM22, NT (TRIM22, RNF94, STAF50, E3 ubiquitin-protein ligase TRIM22, 50kD-stimulated trans-acting factor, RING finger protein 94, Staf-50, Tripartite motif-containing protein 22) (PE) discontinued
043218-PE 200 µL

TRIM22, NT (TRIM22, RNF94, STAF50, E3 ubiquitin-protein ligase TRIM22, 50kD-stimulated trans-acting factor, RING finger protein 94, Staf-50, Tripartite motif-containing protein 22) (PE) discontinued

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (AP) discontinued
130557-AP 100 µL

NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (AP) discontinued

Sign In for Pricing
View Details