Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cst6 Rabbit Polyclonal Antibody (Biotin)

Cst6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ichq, N28197, 1110017E11Rik

UniProt

Q9D1B1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Cst6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS2 Antibody
A19429-100UL 100 µL

DHRS2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g59480 Polyclonal Antibody
MBS9007721 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g59480 Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
MBS2080386-01 0.1 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
MBS2080386-02 0.2 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
MBS2080386-03 0.5 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
MBS2080386-04 1 mL

FITC-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)

Sign In for Pricing
View Details