Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf49 Rabbit Polyclonal Antibody (HRP)

C3orf49 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC17310

UniProt

Q96BT1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf49

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW65417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC124 HDR Plasmid (h)
sc-414063-HDR 20 µg

CCDC124 HDR Plasmid (h)

Sign In for Pricing
View Details
Rabbit Monoclonal Carboxypeptidase M Antibody (105) [FITC]
NBP2-89359F 0.1 mL

Rabbit Monoclonal Carboxypeptidase M Antibody (105) [FITC]

Sign In for Pricing
View Details
RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (MaxLight 650)
MBS6392174-01 0.1 mL

RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (MaxLight 650)

Sign In for Pricing
View Details
RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (MaxLight 650)
MBS6392174-02 5x 0.1 mL

RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (MaxLight 650)

Sign In for Pricing
View Details
CD25 (IL2RA/423), CF488A conjugate, 0.1mg/mL
BNC880423-500 1x 500 µL

CD25 (IL2RA/423), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLM rabbit pAb
RA34142-01 50 µL

PLM rabbit pAb

Sign In for Pricing
View Details