Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AURKC Rabbit Polyclonal Antibody (FITC)

AURKC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C

UniProt

Q9UQB9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AURKC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001015878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) (MaxLight 650)
MBS6224696-01 0.1 mL

SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) (MaxLight 650)

Sign In for Pricing
View Details
SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) (MaxLight 650)
MBS6224696-02 5x 0.1 mL

SLC25A6 (ADP/ATP Translocase 3, ADP,ATP Carrier Protein 3, ADP,ATP Carrier Protein, Isoform T2, ANT 2, Adenine Nucleotide Translocator 3, ANT 3, Solute Carrier Family 25 Member 6, ANT3, CDABP0051) (MaxLight 650)

Sign In for Pricing
View Details
Licorice-saponin H2 (ammonium)
HY-N6911B 1 Each

Licorice-saponin H2 (ammonium)

Sign In for Pricing
View Details
RBBP6 Rabbit Polyclonal Antibody (PE-Cy7)
orb910936 100 µL

RBBP6 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Mt1a ORF Vector (Rat) (pORF)
ORF070870 1.0 µg DNA

Mt1a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
M-Tolyl isocyanate 99%
T16395-01 5 g

M-Tolyl isocyanate 99%

Sign In for Pricing
View Details