Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1L Rabbit Polyclonal Antibody (Biotin)

HSPA1L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP70T, hum70t, HSP70-1L, HSP70-HOM

UniProt

P34931

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_005518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR5 (C-X-C Chemokine Receptor 5, CXCR-5) discontinued
216428 50 µg

CXCR5 (C-X-C Chemokine Receptor 5, CXCR-5) discontinued

Sign In for Pricing
View Details
HSD17b10 (17-Beta-Hydroxysteroid Dehydrogenase Type 10, 17b-HSD10, ABAD, ERAB, HADH2, HCD2, MHBD, SCHAD, SDR5C1, MRPP2, CAMR, 3-Hydroxyacyl-CoA Dehydrogenase Type-2, AB-Binding Alcohol Dehydrogenase)
363510 200 µL

HSD17b10 (17-Beta-Hydroxysteroid Dehydrogenase Type 10, 17b-HSD10, ABAD, ERAB, HADH2, HCD2, MHBD, SCHAD, SDR5C1, MRPP2, CAMR, 3-Hydroxyacyl-CoA Dehydrogenase Type-2, AB-Binding Alcohol Dehydrogenase)

Sign In for Pricing
View Details
CA3 (CIL56)
C13569-10mM/1mL 10 mM/1mL

CA3 (CIL56)

Sign In for Pricing
View Details
Lentiviral mouse AW551984 shRNA (UAS) - Lentiviral mouse AW551984 shRNA (UAS, iRFP) plasmid
GTR15118996 1 Vial

Lentiviral mouse AW551984 shRNA (UAS) - Lentiviral mouse AW551984 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
STFR P010-297x420-PE-CRD/1 AC Signs
823052 Card of 1 Pictogram(s)

STFR P010-297x420-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
RIPK3 Antibody
orb1331681 100 µg

RIPK3 Antibody

Sign In for Pricing
View Details