Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA1L Rabbit Polyclonal Antibody (Biotin)

HSPA1L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP70T, hum70t, HSP70-1L, HSP70-HOM

UniProt

P34931

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_005518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal USP6NL Antibody [Alexa Fluor 647]
NBP1-47264AF647 0.1 mL

Rabbit Polyclonal USP6NL Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)
MBS1058279-01 0.02 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)
MBS1058279-02 0.02 mg (Yeast)

Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)
MBS1058279-03 0.1 mg (E-Coli)

Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)
MBS1058279-04 0.1 mg (Yeast)

Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)
MBS1058279-05 0.02 mg (Baculovirus)

Recombinant Beijerinckia indica subsp. indica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details