Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6B Rabbit Polyclonal Antibody (HRP)

CCT6B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2

UniProt

Q92526

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnao1-set siRNA/shRNA/RNAi Lentivector (Mouse)
22301094 4x 500 ng

Gnao1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Avocadyne-d6 (racemic, mix of diastereomers)
TRC-A794909-50MG 50 mg

Avocadyne-d6 (racemic, mix of diastereomers)

Sign In for Pricing
View Details
PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (MaxLight 650)
MBS6229165-01 0.1 mL

PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (MaxLight 650)

Sign In for Pricing
View Details
PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (MaxLight 650)
MBS6229165-02 5x 0.1 mL

PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (MaxLight 650)

Sign In for Pricing
View Details
EP400 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV670076 1.0 µg DNA

EP400 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)
MBS2107637-01 0.1 mL

HRP-Linked Polyclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details