Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf10 Rabbit Polyclonal Antibody (FITC)

C20orf10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CLG01, C20orf10

UniProt

Q9Y2B4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20orf10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_055292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dennd6b Mouse shRNA Plasmid (Locus ID 69440)
TR515624 1 Kit

Dennd6b Mouse shRNA Plasmid (Locus ID 69440)

Sign In for Pricing
View Details
Phospholipase C (PLC, Cereolysin A, Phosphatidylcholine Cholinephosphohydrolase)
P4074-40B 5 mg

Phospholipase C (PLC, Cereolysin A, Phosphatidylcholine Cholinephosphohydrolase)

Sign In for Pricing
View Details
Rat Farnesyl Diphosphate Farnesyltransferase 1 ELISA kit
GTR10471301 96 Well

Rat Farnesyl Diphosphate Farnesyltransferase 1 ELISA kit

Sign In for Pricing
View Details
Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)
TRV-0055144-01 20 µL

Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)

Sign In for Pricing
View Details
Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)
TRV-0055144-02 100 µL

Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)

Sign In for Pricing
View Details
Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)
TRV-0055144-03 200 µL

Polyclonal Antibody to Intercellular Adhesion Molecule 1 (ICAM1)

Sign In for Pricing
View Details