Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCCPDH Rabbit Polyclonal Antibody (HRP)

SCCPDH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET11, CGI-49

UniProt

Q5R5C9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCCPDH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057086

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Jazf1 qPCR Primer Pair
QM08522S 200 Tests

Mouse Jazf1 qPCR Primer Pair

Sign In for Pricing
View Details
METTL6 Rabbit Polyclonal Antibody
orb325436 100 µL

METTL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Human CD56/NCAM Antibody[B-A19]
E-AB-F1305E-01 20 Tests

APC Anti-Human CD56/NCAM Antibody[B-A19]

Sign In for Pricing
View Details
APC Anti-Human CD56/NCAM Antibody[B-A19]
E-AB-F1305E-02 100 Tests

APC Anti-Human CD56/NCAM Antibody[B-A19]

Sign In for Pricing
View Details
APC Anti-Human CD56/NCAM Antibody[B-A19]
E-AB-F1305E-03 2x 100 Tests

APC Anti-Human CD56/NCAM Antibody[B-A19]

Sign In for Pricing
View Details
IL2RB Rabbit pAb
MBS8559594-01 0.1 mL

IL2RB Rabbit pAb

Sign In for Pricing
View Details