Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA9 Rabbit Polyclonal Antibody (Biotin)

SPACA9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ma, MAST, 1700026L06Rik

UniProt

Q7TPM5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)
MBS6226932-01 0.1 mL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)

Sign In for Pricing
View Details
CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)
MBS6226932-02 5x 0.1 mL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)

Sign In for Pricing
View Details
STK11 antibody
70R-9641 100 µL

STK11 antibody

Sign In for Pricing
View Details
CXCR5, NT (CXCR5, BLR1, MDR15, C-X-C chemokine receptor type 5, Burkitt lymphoma receptor 1, Monocyte-derived receptor 15, CD185) (Biotin) discontinued
034386-Biotin 200 µL

CXCR5, NT (CXCR5, BLR1, MDR15, C-X-C chemokine receptor type 5, Burkitt lymphoma receptor 1, Monocyte-derived receptor 15, CD185) (Biotin) discontinued

Sign In for Pricing
View Details
Human Lymphocyte Antigen 75 (LY75) ELISA Kit
MBS167218-01 48 Well

Human Lymphocyte Antigen 75 (LY75) ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte Antigen 75 (LY75) ELISA Kit
MBS167218-02 96 Well

Human Lymphocyte Antigen 75 (LY75) ELISA Kit

Sign In for Pricing
View Details