Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLF1 Rabbit Polyclonal Antibody (Biotin)

MLF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P58340

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MLF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nolz-1 (m) : 293T Lysate
sc-122093 100 µg - 200 µL

Nolz-1 (m) : 293T Lysate

Sign In for Pricing
View Details
Lentiviral human OPN3 shRNA (UAS) - Lentiviral human OPN3 shRNA (UAS, GFP) (100)
GTR15311664 1 Vial

Lentiviral human OPN3 shRNA (UAS) - Lentiviral human OPN3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Zalunfiban D2 (acetamide-2,2-d2)
CS-O-45764 1 Each

Zalunfiban D2 (acetamide-2,2-d2)

Sign In for Pricing
View Details
(Z) -Metominostrobin
sc-224447 10 mg

(Z) -Metominostrobin

Sign In for Pricing
View Details
UBE2J1, NT (UBE2J1, NCUBE1, Ubiquitin-conjugating enzyme E2 J1, Non-canonical ubiquitin-conjugating enzyme 1, Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (APC) discontinued
043521-APC 200 µL

UBE2J1, NT (UBE2J1, NCUBE1, Ubiquitin-conjugating enzyme E2 J1, Non-canonical ubiquitin-conjugating enzyme 1, Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (APC) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal KIAA1704 Antibody [Alexa Fluor 532]
NBP3-06207AF532 0.1 mL

Rabbit Polyclonal KIAA1704 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details