Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asrgl1 Rabbit Polyclonal Antibody (FITC)

Asrgl1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A, ALP, ALP1, AU040643, AW060375, 2410004D18Rik

UniProt

Q8C0M9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPG2/Heparan Sulfate Proteoglycan 2 Polyclonal Antibody Bio Conjugated
orb1539938 100 µL

HSPG2/Heparan Sulfate Proteoglycan 2 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
GAD2, ID (GAD2, GAD65, Glutamate decarboxylase 2, 65kD glutamic acid decarboxylase, Glutamate decarboxylase 65kD isoform) (APC)
MBS6300951-01 0.2 mL

GAD2, ID (GAD2, GAD65, Glutamate decarboxylase 2, 65kD glutamic acid decarboxylase, Glutamate decarboxylase 65kD isoform) (APC)

Sign In for Pricing
View Details
GAD2, ID (GAD2, GAD65, Glutamate decarboxylase 2, 65kD glutamic acid decarboxylase, Glutamate decarboxylase 65kD isoform) (APC)
MBS6300951-02 5x 0.2 mL

GAD2, ID (GAD2, GAD65, Glutamate decarboxylase 2, 65kD glutamic acid decarboxylase, Glutamate decarboxylase 65kD isoform) (APC)

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor related protein 2 (C1QTNF2) ELISA Kit
GTR10333203 96 Well

Mouse Complement C1q tumor necrosis factor related protein 2 (C1QTNF2) ELISA Kit

Sign In for Pricing
View Details
Anti-GNB5 Antibody Picoband® Fluoro488 Conjugated
A06754-3-Fluoro488 100 µg/Vial

Anti-GNB5 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
C3orf42 AAV siRNA Pooled Vector
53782161 1.0 µg

C3orf42 AAV siRNA Pooled Vector

Sign In for Pricing
View Details